PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G1082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 321aa    MW: 35629.8 Da    PI: 5.9216
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G1082genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-142168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++lv +    G g+W+ +ar  g+ R++k+c++rw +yl
      Gh_D09G1082 21 KGLWSPEEDDKLVTYMLTNGRGCWSDVARNAGLQRCGKSCRLRWINYL 68
                     678*******************************************97 PP

2Myb_DNA-binding51.13.1e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+v+++  lG++ W+ Ia++++ gRt++++k++w++
      Gh_D09G1082  74 RGAFSPQEQELIVHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 117
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6931668IPR017930Myb domain
SuperFamilySSF466891.12E-2719115IPR009057Homeodomain-like
SMARTSM007173.7E-112070IPR001005SANT/Myb domain
PfamPF002494.3E-132168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-222275IPR009057Homeodomain-like
CDDcd001672.95E-92468No hitNo description
PROSITE profilePS5129425.15369123IPR017930Myb domain
SMARTSM007172.6E-1573121IPR001005SANT/Myb domain
PfamPF002491.4E-1474117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2576124IPR009057Homeodomain-like
CDDcd001678.33E-1176116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MMRKPPSMKG NNSNGTNKHK KGLWSPEEDD KLVTYMLTNG RGCWSDVARN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSPQ EQELIVHLHS ILGNRWSQIA ARLPGRTDNE IKNFWNSTIK  120
KRLKHSSSTA SHNASDSSSE PNKDAMAAGF MTMLEQEVPP IYLDLSSAWS NSFLQSMVLN  180
HSGNSLPMLQ HGRNVVGAVG YFDPAGSCVT QAEVNGDSSL GESEIFGSVD NGIERELYVP  240
PLESIGKDLK TENSVDGNIN NGFNIINTSG VRSDNNNNMS KNMDSDDVGS FWIGEELKVG  300
EWDMENLMKD VSSFPFLDFQ S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26211237108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5897873e-89JX589787.1 Gossypium hirsutum clone NBRI_GE24554 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485407.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0D2RVA40.0A0A0D2RVA4_G
STRINGGLYMA11G14200.21e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-70myb domain protein 46